PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P11790_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TCP
Protein Properties Length: 235aa    MW: 26007.1 Da    PI: 10.2012
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P11790_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP118.58.4e-3725104281
                     TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssss 81 
                             a+k+ ++ ++hTkv+gR+RRvR++a+caar+F+L++eLG+++d++ti+WLlqqa+ +i+++tg+++++as+ e+++s+++
  GSMUA_Achr10P11790_001  25 APKRNSKNDRHTKVDGRGRRVRMPALCAARIFQLTRELGHKSDGETIQWLLQQAESSIIAATGSGTIPASFQESGQSRVN 104
                             7899*****************************************************************88855555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.8E-3130190IPR005333Transcription factor, TCP
PROSITE profilePS5136926.5913185IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MTSQPNRNAH LAVTAEKGEQ RRHLAPKRNS KNDRHTKVDG RGRRVRMPAL CAARIFQLTR  60
ELGHKSDGET IQWLLQQAES SIIAATGSGT IPASFQESGQ SRVNWATFGR PHPELWLPPV  120
DGFDTSFFHS AAAAMPVASN LPRIGFPALE FPGTNPNQMS FTSLLGGQRP PMPGLELGLS  180
QHGQVRIFNP QALSQFYQHI GQGSDHLHLH QHQQVQQEQH QKSPTPNEKS EVSAE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009421054.11e-154PREDICTED: transcription factor TCP20-like
SwissprotQ9LSD55e-56TCP20_ARATH; Transcription factor TCP20
TrEMBLM0RHF51e-174M0RHF5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P11790_0011e-174(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.16e-57TCP family protein